Antibodies

View as table Download

gamma Adaptin (AP1G1) mouse monoclonal antibody, clone IMD-113, Purified

Applications WB
Reactivities Human, Rat

Goat polyclonal anti-AP1G1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 646-659 of Human AP1G1.

Rabbit Polyclonal Anti-AP1G1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AP1G1 antibody: synthetic peptide directed towards the C terminal of human AP1G1. Synthetic peptide located within the following region: DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS