Antibodies

Jump to Filters
View as table Download
Germinal Center Kinase (MAP4K2) Rabbit Polyclonal Antibody
TA346723

USD 475.00

5 Days

Rabbit Polyclonal Anti-MAP4K2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP4K2 antibody: synthetic peptide directed towards the N terminal of human MAP4K2. Synthetic peptide located within the following region: TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR
Germinal Center Kinase (MAP4K2) Rabbit Polyclonal Antibody
TA346724

USD 475.00

5 Days

Rabbit Polyclonal Anti-MAP4K2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP4K2 antibody: synthetic peptide directed towards the N terminal of human MAP4K2. Synthetic peptide located within the following region: HLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAE
Germinal Center Kinase (MAP4K2) (Center) Rabbit Polyclonal Antibody
AP52600PU-N

USD 450.00

2 Weeks

Germinal Center Kinase (MAP4K2) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 320-349 amino acids from the Central region of human MAP4K2
Germinal Center Kinase (MAP4K2) Rabbit Polyclonal Antibody
TA349584

USD 345.00

In Stock

Rabbit Polyclonal Anti-MAP4K2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MAP4K2