Antibodies

View as table Download

Goat Anti-CPT1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KSSTKTDSHRLGQH, from the internal region of the protein sequence according to NP_689572.1; NP_001129524.1.

Goat Polyclonal Antibody against FABP2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EGVEAKRIFKKD, from the C Terminus of the protein sequence according to NP_000125.1.

Rabbit polyclonal anti-SCD (stearoyl-CoA desaturase) antibody

Applications WB
Reactivities Hamster, Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 206 of rat SCD

Goat Polyclonal Antibody against PCK2 / PEPCK-M

Applications WB
Reactivities Human, Mouse, Rat, Guinea Pig
Conjugation Unconjugated
Immunogen Peptide with sequence KPWKPGDKEPCAH, from the internal region of the protein sequence according to NP_004554.2.

Goat Polyclonal Antibody against PPAR delta (Isoform 1)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CHPLLQEIYKDMY, from the C Terminus of the protein sequence according to NP_006229.1.

Goat Polyclonal Antibody against RXR beta

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CRDGMGDSGRDSRSP, from the internal region of the protein sequence according to NP_068811.

Goat Polyclonal Antibody against RXR gamma

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RQRSRERAESEAEC, from the internal region of the protein sequence according to NP_008848.

Rabbit polyclonal antibody to Retinoid X Receptor beta (retinoid X receptor, beta)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 20 and 113 of Retinoid X Receptor beta (Uniprot ID#P28702)

Goat Anti-CPT2 (aa141-154) Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-PKSEYNDQLTRATN, from the internal region of the protein sequence according to NP_000089.1.

Goat Anti-FACL4 / ACSL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HYLKDIERMYGGK, from the C Terminus of the protein sequence according to NP_004449.1; NP_075266.1.

Rabbit Polyclonal Anti-PCK1 Antibody

Applications WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS