Antibodies

View as table Download

SHMT1 (374-483) mouse monoclonal antibody, clone 4F9, Purified

Applications ELISA, IHC, WB
Reactivities Human

Rabbit polyclonal Anti-SHMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT1 antibody: synthetic peptide directed towards the N terminal of human SHMT1. Synthetic peptide located within the following region: NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG