Myeloperoxidase (MPO) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence mapping at the C-terminal of Human MPO |
Myeloperoxidase (MPO) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence mapping at the C-terminal of Human MPO |
Rabbit Polyclonal Anti-MPO Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MPO antibody: synthetic peptide directed towards the N terminal of human MPO. Synthetic peptide located within the following region: QLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVR |
Myeloperoxidase (MPO) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 66-97aa) of human Myeloperoxidase |
Myeloperoxidase (MPO) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 547-575 amino acids from the C-terminal region of Human Myeloperoxidase. |
Rabbit polyclonal anti-Myeloperoxidase (MPO) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 765 of human MPO |
Rabbit polyclonal Myeloperoxidase antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Myeloperoxidase [Human Leukocytes] |
MPO Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MPO |
Myeloperoxidase (MPO) Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-310 of human Myeloperoxidase (MPO) (NP_000241.1). |
Modifications | Unmodified |