Antibodies

View as table Download

Rabbit Polyclonal Anti-PTP4A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTP4A3 antibody: synthetic peptide directed towards the C terminal of human PTP4A3. Synthetic peptide located within the following region: MKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM

Anti-PTP4A3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around aa. 161-166 (K-D-P-H-T) derived from Human PTP4A3.

PTP4A3 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PRL-3 around the site of 160.

PTP4A3 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PRL-3 around the site of 160.

Rabbit Polyclonal Anti-PTP4A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTP4A3 antibody: synthetic peptide directed towards the middle region of human PTP4A3. Synthetic peptide located within the following region: LGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQR

PTP4A3 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PTP4A3

PTP4A3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human PTP4A3 (NP_009010.2).
Modifications Unmodified