Vitronectin Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 364-478 of human Vitronectin (NP_000629.3). |
| Modifications | Unmodified |
Vitronectin Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 364-478 of human Vitronectin (NP_000629.3). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-VTN Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VTN antibody: synthetic peptide directed towards the N terminal of human VTN. Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE |
Rabbit polyclonal VTN Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This VTN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 65-93 amino acids from the N-terminal region of human VTN. |
Vitronectin Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 399-478 of human Vitronectin (NP_000629.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
