Vitronectin (VTN) Rabbit Polyclonal Antibody

CAT#: TA344462

Rabbit Polyclonal Anti-VTN Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: VTN; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: VTN; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-VTN Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysateVTN is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VTN antibody: synthetic peptide directed towards the N terminal of human VTN. Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: vitronectin
• Database Link:
  NP_000629
  Entrez Gene 7448 Human
  UniProt ID P04004
• Background: VTN is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond.The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: V75; VN; VNT
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: ECM-receptor interaction, Focal adhesion