Antibodies

Jump to Filters
View as table Download
ADAMDEC1 Rabbit Polyclonal Antibody
TA315381

USD 345.00

4 Weeks

Rabbit polyclonal anti-ADAMDEC1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADAMDEC1.
ADAMDEC1 Rabbit Polyclonal Antibody
TA334544

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADAMDEC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAMDEC1 antibody: synthetic peptide directed towards the middle region of human ADAMDEC1. Synthetic peptide located within the following region: GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL
ADAMDEC1 Rabbit Polyclonal Antibody
TA373264

USD 275.00

3 Weeks

ADAMDEC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 206-470 of human ADAMDEC1 (NP_055294.1).
Modifications Unmodified