ADAMDEC1 Rabbit Polyclonal Antibody

CAT#: TA334544

Rabbit Polyclonal Anti-ADAMDEC1 Antibody

Product Images

WB Suggested Anti-ADAMDEC1 Antibody Titration: 0.2-1 ug/ml; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADAMDEC1 antibody: synthetic peptide directed towards the middle region of human ADAMDEC1. Synthetic peptide located within the following region: GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: ADAM like decysin 1
• Database Link:
  NP_055294
  Entrez Gene 27299 Human
  UniProt ID O15204
• Background: This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their interactions with germinal center T cells. [provided by RefSeq, Jul 2008]
• Synonyms: M12.219
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein