Antibodies

View as table Download

Rabbit Polyclonal Anti-CLDND1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CLDND1

Rabbit Polyclonal Anti-CLDND1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLDND1 Antibody: synthetic peptide directed towards the middle region of human CLDND1. Synthetic peptide located within the following region: TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL

CLDND1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDND1