Antibodies

Jump to Filters
View as table Download
CYB561D1 Rabbit Polyclonal Antibody
TA335350

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYB561D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYB561D1 Antibody is: synthetic peptide directed towards the middle region of Human CYB561D1. Synthetic peptide located within the following region: TGPLMEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSA