CYB561D1 Rabbit Polyclonal Antibody

CAT#: TA335350

Rabbit Polyclonal Anti-CYB561D1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CYB561D1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CYB561D1 Antibody is: synthetic peptide directed towards the middle region of Human CYB561D1. Synthetic peptide located within the following region: TGPLMEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 14 kDa
Gene Name cytochrome b561 family member D1
Background The function of this protein remains unknown.
Synonyms RP5-831G13.3
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.