Antibodies

Jump to Filters
View as table Download
CYB561D1 (C-term) Rabbit Polyclonal Antibody
AP51154PU-N

USD 450.00

2 Weeks

CYB561D1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 200-229aa) of human CYB561D1.
CYB561D1 Rabbit Polyclonal Antibody
TA335350

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYB561D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYB561D1 Antibody is: synthetic peptide directed towards the middle region of Human CYB561D1. Synthetic peptide located within the following region: TGPLMEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSA