Antibodies

View as table Download

CYB561D1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 200-229aa) of human CYB561D1.

Rabbit Polyclonal Anti-CYB561D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYB561D1 Antibody is: synthetic peptide directed towards the middle region of Human CYB561D1. Synthetic peptide located within the following region: TGPLMEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSA