Rabbit Polyclonal DBX1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DBX1 antibody was raised against a 15 amino acid synthetic peptide near the center of human DBX1. |
Rabbit Polyclonal DBX1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DBX1 antibody was raised against a 15 amino acid synthetic peptide near the center of human DBX1. |
Rabbit Polyclonal Anti-DBX1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DBX1 antibody: synthetic peptide directed towards the middle region of human DBX1. Synthetic peptide located within the following region: GGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDP |