Antibodies

Jump to Filters
View as table Download
DBX1 Rabbit Polyclonal Antibody
TA320087

USD 430.00

5 Days

Rabbit Polyclonal DBX1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DBX1 antibody was raised against a 15 amino acid synthetic peptide near the center of human DBX1.
DBX1 Rabbit Polyclonal Antibody
TA339648

USD 375.00

5 Days

Rabbit Polyclonal Anti-DBX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DBX1 antibody: synthetic peptide directed towards the middle region of human DBX1. Synthetic peptide located within the following region: GGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDP