Antibodies

View as table Download

DDB2 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DDB2

Rabbit Polyclonal Anti-DDB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDB2 antibody: synthetic peptide directed towards the C terminal of human DDB2. Synthetic peptide located within the following region: IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEF

Carrier-free (BSA/glycerol-free) DDB2 mouse monoclonal antibody,clone OTI2E12

Applications WB
Reactivities Human
Conjugation Unconjugated

DDB2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DDB2

DDB2 mouse monoclonal antibody,clone OTI2E12

Applications WB
Reactivities Human
Conjugation Unconjugated

DDB2 mouse monoclonal antibody,clone OTI2E12, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP