Antibodies

View as table Download

Rabbit Polyclonal ECT2 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal ECT2 phospho T790 antibody (Phospho-specific)

Applications WB
Reactivities Chimpanzee, Chicken, Human, Mouse, Rat, Zebrafish, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 785-795 of human ECT2 protein.
Modifications Phospho-specific

Rabbit Polyclonal Anti-ECT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ECT2 antibody: synthetic peptide directed towards the middle region of human ECT2. Synthetic peptide located within the following region: PECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSL

Rabbit Polyclonal Anti-ECT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ECT2 antibody: synthetic peptide directed towards the middle region of human ECT2. Synthetic peptide located within the following region: KKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG

Carrier-free (BSA/glycerol-free) ECT2 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ECT2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human ECT2

ECT2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ECT2.
Modifications Unmodified

ECT2 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ECT2 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated