Rabbit Polyclonal Anti-EIF4E3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4E3 antibody: synthetic peptide directed towards the middle region of human EIF4E3. Synthetic peptide located within the following region: VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH |
Carrier-free (BSA/glycerol-free) EIF4E3 mouse monoclonal antibody,clone OTI1D1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
EIF4E3 mouse monoclonal antibody,clone OTI1D1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
EIF4E3 mouse monoclonal antibody,clone OTI1D1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
EIF4E3 mouse monoclonal antibody,clone OTI1D1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
EIF4E3 mouse monoclonal antibody,clone OTI1D1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
