EIF4E3 Rabbit Polyclonal Antibody

CAT#: TA344020

Rabbit Polyclonal Anti-EIF4E3 Antibody

Product Images

WB Suggested Anti-EIF4E3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF4E3 antibody: synthetic peptide directed towards the middle region of human EIF4E3. Synthetic peptide located within the following region: VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: eukaryotic translation initiation factor 4E family member 3
• Database Link:
  NP_001128121
  Entrez Gene 317649 Human
  UniProt ID Q8N5X7
• Background: EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome.
• Synonyms: eIF-4E3; eIF4E-3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%