Rabbit Polyclonal Factor VIII Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Factor VIII. |
Rabbit Polyclonal Factor VIII Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Factor VIII. |
Rabbit Polyclonal Anti-F8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F8 antibody: synthetic peptide directed towards the C terminal of human F8. Synthetic peptide located within the following region: IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ |
Factor VIII Rabbit polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthesized peptide derived from the C-terminal region of human Factor VIII. at AA rangle: 2130-2210 |