Antibodies

View as table Download

Rabbit Polyclonal Factor VIII Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Factor VIII.

Rabbit Polyclonal Anti-F8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F8 antibody: synthetic peptide directed towards the C terminal of human F8. Synthetic peptide located within the following region: IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ

Factor VIII Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthesized peptide derived from the C-terminal region of human Factor VIII. at AA rangle: 2130-2210