Antibodies

Jump to Filters
View as table Download
FT1A (FUT6) Rabbit Polyclonal Antibody
TA346667

USD 475.00

5 Days

Rabbit Polyclonal Anti-FUT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUT6 antibody: synthetic peptide directed towards the C terminal of human FUT6. Synthetic peptide located within the following region: YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR
FT1A (FUT6) Rabbit Polyclonal Antibody
TA376391

USD 220.00

3 Weeks

FUT6 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-359 of human FUT6 (NP_000141.1).
Modifications Unmodified