Antibodies

Jump to Filters
View as table Download
GABRR2 Rabbit Polyclonal Antibody
TA338522

USD 375.00

5 Days

Rabbit Polyclonal Anti-GABRR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRR2 antibody: synthetic peptide directed towards the middle region of human GABRR2. Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY
GABRR2 Rabbit Polyclonal Antibody
TA376456

USD 220.00

3 Weeks

GABRR2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human GABRR2 (NP_002034.3).
Modifications Unmodified