Antibodies

Jump to Filters
View as table Download
B MyB (MYBL2) Rabbit Polyclonal Antibody
TA330054

USD 375.00

5 Days

Rabbit Polyclonal Anti-MYBL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYBL2 antibody: synthetic peptide directed towards the N terminal of human MYBL2. Synthetic peptide located within the following region: RCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWK