Antibodies

View as table Download

Rabbit Polyclonal Anti-PEA15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PEA15 antibody: synthetic peptide directed towards the middle region of human PEA15. Synthetic peptide located within the following region: DLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKL

Rabbit polyclonal PEA-15 (Ser104) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PEA-15 around the phosphorylation site of serine 104(I-P-SP-A-K).
Modifications Phospho-specific

PEA15 Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PEA15

PEA15 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEA15 (NP_003759.1).
Modifications Unmodified

Phospho-PEA15-S104 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S104 of human PEA15 (NP_003759.1).
Modifications Phospho S104

Phospho-PEA15-S104 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S104 of human PEA15 (NP_003759.1).
Modifications Phospho S104