PEA15 Rabbit Polyclonal Antibody

CAT#: TA346580

Rabbit Polyclonal Anti-PEA15 Antibody

Product Images

WB Suggested Anti-PEA15 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate

• 

  WB Suggested Anti-PEA15 Antibody; Positive Control: Lane 1: 20ug EGFP-transfected MCF7 lysate Lane 2: 20ug EGFP-PEA15 transfected MCF7 lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Goat anti-rabbit-HRP; Secondry Antibody Dilution: 1: 5000;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PEA15 antibody: synthetic peptide directed towards the middle region of human PEA15. Synthetic peptide located within the following region: DLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: phosphoprotein enriched in astrocytes 15
• Database Link:
  NP_003759
  Entrez Gene 8682 Human
  UniProt ID Q15121
• Background: This gene encodes a death effector domain-containing protein that functions as a negative regulator of apoptosis. The encoded protein is an endogenous substrate for protein kinase C. This protein is also overexpressed in type 2 diabetes mellitus, where it may contribute to insulin resistance in glucose uptake. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Synonyms: HMAT1; HUMMAT1H; MAT1; MAT1H; PEA-15; PED
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome