Rabbit Polyclonal Anti-RABEPK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RABEPK antibody: synthetic peptide directed towards the N terminal of human RABEPK. Synthetic peptide located within the following region: MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV |
Rabbit Polyclonal Anti-RABEPK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RABEPK antibody: synthetic peptide directed towards the N terminal of human RABEPK. Synthetic peptide located within the following region: SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL |
RABEPK Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RABEPK |
RAB9P40 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human RAB9P40 (NP_005824.2). |
| Modifications | Unmodified |
p40 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China