Antibodies

Jump to Filters
View as table Download
FAM82A1 (RMDN2) Chicken Polyclonal Antibody
TA306964

USD 430.00

5 Days

Chicken Polyclonal FAM82A1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen FAM82A1 antibody was raised against a 16 amino acid peptide near the amino terminus of human FAM82A1.
FAM82A1 (RMDN2) Rabbit Polyclonal Antibody
TA340361

USD 375.00

5 Days

Rabbit Polyclonal Anti-RMDN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RMDN2 antibody: synthetic peptide directed towards the middle region of human RMDN2. Synthetic peptide located within the following region: WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV
FAM82A1 (RMDN2) Rabbit Polyclonal Antibody
TA340362

USD 375.00

5 Days

Rabbit Polyclonal Anti-RMDN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RMDN2 antibody: synthetic peptide directed towards the middle region of human RMDN2. Synthetic peptide located within the following region: RAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLPEEP
FAM82A1 (RMDN2) Rabbit Polyclonal Antibody
TA361106

USD 360.00

5 Days

RMDN2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FAM82A1
RMDN2 Rabbit Polyclonal Antibody
TA366255

USD 380.00

4 Weeks

RMDN2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RMDN2