Antibodies

Jump to Filters
View as table Download
Somatostatin Receptor 4 (SSTR4) Rabbit Polyclonal Antibody
TA314571

USD 345.00

In Stock

Rabbit polyclonal anti-SSTR4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SSTR4.
Sstr4 Rabbit Polyclonal Antibody
TA333889

USD 375.00

5 Days

Rabbit Polyclonal Anti-SSTR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SSTR4 Antibody: synthetic peptide directed towards the middle region of human SSTR4. Synthetic peptide located within the following region: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV
Sstr4 Rabbit Polyclonal Antibody
TA333890

USD 310.00

5 Days

Rabbit Polyclonal Anti-SSTR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SSTR4 Antibody: synthetic peptide directed towards the middle region of human SSTR4. Synthetic peptide located within the following region: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV
Somatostatin Receptor 4 (SSTR4) Mouse Monoclonal Antibody [Clone ID: OTI2F11]
CF808224

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SSTR4 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Somatostatin Receptor 4 (SSTR4) Rabbit Polyclonal Antibody
TA382049

USD 220.00

3 Weeks

SSTR4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 314-388 of human SSTR4 (NP_001043.2).
Modifications Unmodified