Sstr4 Rabbit Polyclonal Antibody

CAT#: TA333890

Rabbit Polyclonal Anti-SSTR4 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Sstr4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SSTR4 Antibody: synthetic peptide directed towards the middle region of human SSTR4. Synthetic peptide located within the following region: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 42 kDa
Gene Name somatostatin receptor 4
Background Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR4 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in fetal and adult brain and lung.
Synonyms SS4R
Note Immunogen sequence homology: Mouse: 85%; Rabbit: 78%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.