Antibodies

Jump to Filters
View as table Download
ZZZ3 Rabbit Polyclonal Antibody
TA339718

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZZZ3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZZZ3 antibody: synthetic peptide directed towards the middle region of human ZZZ3. Synthetic peptide located within the following region: VKLVFDKVGLPARPKSPLDPKKDGESLSYSMLPLSDGPEGSSSRPQMIRG
ZZZ3 Rabbit Polyclonal Antibody
TA383636

USD 220.00

3 Weeks

ZZZ3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ZZZ3
Modifications Unmodified