ZZZ3 Rabbit Polyclonal Antibody

CAT#: TA339718

Rabbit Polyclonal Anti-ZZZ3 Antibody

Product Images

WB Suggested Anti-ZZZ3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZZZ3 antibody: synthetic peptide directed towards the middle region of human ZZZ3. Synthetic peptide located within the following region: VKLVFDKVGLPARPKSPLDPKKDGESLSYSMLPLSDGPEGSSSRPQMIRG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: zinc finger ZZ-type containing 3
• Database Link:
  NP_056349
  Entrez Gene 26009 Human
  UniProt ID Q8IYH5
• Background: ZZZ3 contains 1 HTH myb-type DNA-binding domain and 1 ZZ-type zinc finger. The exact function of ZZZ3 remains unknown.
• Synonyms: ATAC1
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 92%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors