Antibodies

Jump to Filters
View as table Download
Gja8 Rabbit Polyclonal Antibody
TA329539

USD 375.00

5 Days

Rabbit Polyclonal anti-Gja8 antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Gja8 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MGDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQS
GJA8 Rabbit Polyclonal Antibody
TA376578

USD 220.00

3 Weeks

GJA8 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GJA8.
Modifications Unmodified