Gja8 Rabbit Polyclonal Antibody

CAT#: TA329539

Rabbit Polyclonal anti-Gja8 antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Gja8"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse, Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Gja8 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MGDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 49 kDa
Gene Name gap junction protein, alpha 8
Background One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Synonyms CAE; CAE1; Connexin-50; CX50; CZP1; MP70; OTTHUMP00000025757
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 82%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.