Rabbit Polyclonal anti-Gja8 antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gja8 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MGDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQS |
Rabbit Polyclonal Anti-GJA8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJA8 antibody: synthetic peptide directed towards the middle region of human GJA8. Synthetic peptide located within the following region: EEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPEL |
Rabbit Polyclonal Anti-GJA8 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GJA8 |
GJA8 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GJA8 |
GJA8 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GJA8. |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China