Antibodies

View as table Download

Rabbit polyclonal Anti-KCa1.1 (BKCa) (extracellular)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DSSNPIES(S)QNFYKD, corresponding to amino acid residues 199-213 of rat KCa1.1 . 1st extracellular loop.

Rabbit polyclonal Anti-KCa1.1 (1184-1200)

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)STANRPNRPKSRESRDK, corresponding to amino acid residues 1184-1200 of mouse KCa1.1. Intracellular, C-terminal part.

Rabbit polyclonal Anti-KCa1.1 (1098-1196)

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen GST fusion protein with the sequence SHSSHSSQ SSSKKSSSVHSIPSTANRPNRPKSRESRDKQNATRMTRMG QAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIP PIREVEDEC, corresponding to residues 1097-1196 of mouse KCa1.1 variant 2 . Intracellular, C-terminus.