Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Anti-MeCP2 (Ser80) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser80 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MECP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MECP2 antibody: synthetic peptide directed towards the N terminal of human MECP2. Synthetic peptide located within the following region: KKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQR |
Rabbit Polyclonal Anti-MECP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MECP2 antibody: synthetic peptide directed towards the middle region of human MECP2. Synthetic peptide located within the following region: EPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPV |
MECP2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human MECP2 (NP_004983.1). |
| Modifications | Unmodified |
Anti-MeCP2 (Ser421) Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser421 of mouse MeCP2, conjugated to keyhole limpet hemocyanin (KLH). |
USD 420.00
4 Weeks
Active filters
Target Symbol
- MECP2
Reactivities
- Mouse
Applications
- WB