Rabbit Polyclonal Anti-TERF2IP Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Terf2ip antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHK |
Goat Anti-RAP1 / TERF2IP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GAQNVARRIEFRKK, from the C Terminus of the protein sequence according to NP_061848.2. |
TERF2IP Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human TERF2IP (NP_061848.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China