RAP1 (TERF2IP) Rabbit Polyclonal Antibody

CAT#: TA344832

Rabbit Polyclonal Anti-TERF2IP Antibody - middle region

Product Images

WB Suggested Anti-Terf2ip Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Pancreas

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Terf2ip antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: TERF2 interacting protein
• Database Link:
  NP_061848
  Entrez Gene 57321 Mouse
  UniProt ID Q9NYB0
• Background: Terf2ip acts both as a regulator of telomere function and as a transcription regulator. It is involved in the regulation of telomere length and protection as a component of the shelterin complex (telosome). In contrast to other components of the shelterin complex, it is dispensible for telomere capping and does not participate in the protection of telomeres against non-homologous end-joining (NHEJ)-mediated repair. Instead, it is required to negatively regulate telomere recombination and is essential for repressing homology-directed repair (HDR), which can affect telomere length.
• Synonyms: DRIP5; RAP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%

Reference Data

• Protein Families: Transcription Factors