Rabbit Polyclonal Anti-IDH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IDH2 antibody: synthetic peptide directed towards the middle region of human IDH2. Synthetic peptide located within the following region: GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK |
Goat Anti-IDH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CIHGLSNVKLNE, from the internal region of the protein sequence according to NP_002159.2. |
IDH2 Rabbit polyclonal Antibody
| Applications | ChIP, IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 193-452 of human IDH2 (NP_002159.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
