Antibodies

Jump to Filters
View as table Download
SENP5 Rabbit Polyclonal Antibody
TA329775

USD 375.00

5 Days

Rabbit polyclonal Anti-SENP5 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SENP5 antibody: synthetic peptide directed towards the middle region of human SENP5. Synthetic peptide located within the following region: LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR