Antibodies

Jump to Filters
View as table Download
BIGM103 (SLC39A8) Rabbit Polyclonal Antibody
TA333707

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC39A8 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC39A8 Antibody: synthetic peptide directed towards the N terminal of human SLC39A8. Synthetic peptide located within the following region: QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS