BIGM103 (SLC39A8) Rabbit Polyclonal Antibody

CAT#: TA333707

Rabbit Polyclonal Anti-SLC39A8 Antibody

Product Images

WB Suggested Anti-SLC39A8 Antibody Titration: 0.2-1 ug/ml; Positive Control: NCI-H226 cell lysate;There is BioGPS gene expression data showing that SLC39A8 is expressed in NCIH226

• 

  Sample Type : Human Pancreas (Cancer) & rat pancreas Primary Antibody Dilution : 1:150;Secondary Antibody : Goat anti-Rabbit;Secondary Antibody Dilution : 1:300;Gene Name : SLC39A8;Submitted by : Anonymous

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC39A8 Antibody: synthetic peptide directed towards the N terminal of human SLC39A8. Synthetic peptide located within the following region: QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: solute carrier family 39 member 8
• Database Link:
  NP_071437
  Entrez Gene 64116 Human
  UniProt ID Q9C0K1
• Background: This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import
• Synonyms: BIGM103; CDG2N; LZT-Hs6; PP3105; ZIP8
• Note: Immunogen sequence homology: Human: 100%; Pig: 85%; Dog: 79%; Horse: 79%

Reference Data

• Protein Families: Transmembrane