Antibodies

Jump to Filters
View as table Download
ADAM2 Rabbit Polyclonal Antibody
TA324288

USD 345.00

In Stock

Anti-ADAM2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human ADAM metallopeptidase domain 2
ADAM2 Rabbit Polyclonal Antibody
TA335864

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADAM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADAM2 Antibody: synthetic peptide directed towards the middle region of human ADAM2. Synthetic peptide located within the following region: PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL
ADAM2 Rabbit Polyclonal Antibody
TA357130

USD 360.00

5 Days

ADAM2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
ADAM2 Rabbit Polyclonal Antibody
TA362045

USD 360.00

5 Days

ADAM2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ADAM2
ADAM2 Rabbit Polyclonal Antibody
TA373256

USD 275.00

3 Weeks

ADAM2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADAM2
Modifications Unmodified