Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 21 of 21 results

(reset)

CD13 (ANPEP) Rabbit Monoclonal Antibody [Clone ID: EPR4058]

TA307568

USD 520.00

In Stock

Rabbit monoclonal antibody against CD13(clone EPR4058)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

CD13 (ANPEP) Rabbit Polyclonal Antibody

AP20647PU-N

USD 370.00

2 Weeks

CD13 (ANPEP) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide, corresponding to amino acids 880-930 of Human CD13.

1 / 2

2 / 2

Previous Next

CD13 (ANPEP) Rabbit Polyclonal Antibody

TA332824

USD 275.00

3 Weeks

Rabbit anti-ANPEP Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ANPEP

CD13 (ANPEP) Rabbit Polyclonal Antibody

TA343101

USD 375.00

5 Days

Rabbit Polyclonal Anti-ANPEP Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA

CD13 (ANPEP) Goat Polyclonal Antibody

TA329672

USD 375.00

5 Days

Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2

CD13 (ANPEP) Goat Polyclonal Antibody

TA329673

USD 375.00

5 Days

Goat Anti-CD13 / ANPEP Polyclonal Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

CF807395

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2F10]

CF807396

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI3F8]

CF807397

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

TA807395

USD 379.00

In Stock

ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]

TA807395AM

USD 420.00

4 Weeks

ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E4]

TA807395BM

USD 420.00

4 Weeks

ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

TA807395S

USD 159.00

2 Days

ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2F10]

TA807396

USD 379.00

In Stock

ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F10]

TA807396AM

USD 420.00

4 Weeks

ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F10]

TA807396BM

USD 420.00

4 Weeks

ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2F10]

TA807396S

USD 159.00

In Stock

ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI3F8]

TA807397

USD 379.00

In Stock

ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F8]

TA807397AM

USD 420.00

4 Weeks

ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F8]

TA807397BM

USD 420.00

4 Weeks

ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI3F8]

TA807397S

USD 159.00

2 Days

ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 21 of 21 results