CD13 (ANPEP) Rabbit Polyclonal Antibody

CAT#: TA343101

Rabbit Polyclonal Anti-ANPEP Antibody

Product Images

WB Suggested Anti-ANPEP Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 106 kDa
• Gene Name: alanyl aminopeptidase, membrane
• Database Link:
  NP_001141
  Entrez Gene 290 Human
  UniProt ID P15144
• Background: Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. Human aminopeptidase N is a receptor for one strain of human coronavirus that is an important cause of upper respiratory tract infections. Defects in this gene appear to be a cause of various types of leukemia or lymphoma.
• Synonyms: APN; CD13; GP150; LAP1; P150; PEPN
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Pig: 85%; Guinea pig: 85%; Dog: 79%; Rat: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Protease, Transmembrane
• Protein Pathways: Glutathione metabolism, Hematopoietic cell lineage, Metabolic pathways, Renin-angiotensin system