Rabbit Polyclonal Anti-ASCL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASCL1 antibody: synthetic peptide directed towards the N terminal of human ASCL1. Synthetic peptide located within the following region: QSAQQQQQQQQQQQQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELM |
Rabbit polyclonal ASCL1 Antibody(N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ASCL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 63-90 amino acids from the N-terminal region of human ASCL1. |
Rabbit Polyclonal anti-ASCL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ASCL1 antibody is: synthetic peptide directed towards the N-terminal region of Human ASCL1. Synthetic peptide located within the following region: AQQQQQQQQQQQQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRC |
Rabbit Polyclonal Anti-ASCL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASCL1 antibody: synthetic peptide directed towards the middle region of human ASCL1. Synthetic peptide located within the following region: AGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNW |
AscL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 77-236 of human AscL1 (NP_004307.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
