Antibodies

Jump to Filters
View as table Download
Chymotrypsin (CTRC) Rabbit Polyclonal Antibody
TA334675

USD 375.00

5 Days

Rabbit Polyclonal Anti-CTRC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTRC antibody: synthetic peptide directed towards the N terminal of human CTRC. Synthetic peptide located within the following region: LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK
Chymotrypsin (CTRC) Rabbit Polyclonal Antibody
TA375211

USD 220.00

3 Weeks

CTRC Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-150 of human CTRC (NP_009203.2).
Modifications Unmodified