Chymotrypsin (CTRC) Rabbit Polyclonal Antibody

CAT#: TA334675

Rabbit Polyclonal Anti-CTRC Antibody

Product Images

WB Suggested Anti-CTRC Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CTRC antibody: synthetic peptide directed towards the N terminal of human CTRC. Synthetic peptide located within the following region: LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: chymotrypsin C
• Database Link:
  NP_009203
  Entrez Gene 11330 Human
  UniProt ID Q99895
• Background: CTRC is a member of the peptidase S1 family. The protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. This gene encodes a member of the peptidase S1 family. The encoded protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.
• Synonyms: CLCR; ELA4
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 93%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Protease