CUEDC2 (C-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CUEDC2 antibody was raised against cUEDC2 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human CUEDC2. |
CUEDC2 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human CUEDC2 |
Anti-CUEDC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.262~266(D-V-R-N-P) derived from Human CUEDC2. |
Rabbit Polyclonal CUEDC2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Bovine, Canine, Equine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acid 250-300 of human CUEDC2 was used as the immunogen. |
Rabbit Polyclonal Anti-CUEDC2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cuedc2 antibody is: synthetic peptide directed towards the middle region of Mouse Cuedc2. Synthetic peptide located within the following region: IPRGIIGDMMQKLSVQLSDARNKENLHPQSSCVQGQVPIFPETPRQAEKL |
CUEDC2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CUEDC2 (NP_076945.2). |
| Modifications | Unmodified |
USD 420.00
5 Days
CUEDC2 mouse monoclonal antibody,clone OTI2H6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
