Antibodies

View as table Download

EPOR (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 328-357 amino acids from the Central region of Human Erythropoietin receptor

Rabbit Polyclonal Epo-R Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Epo-R

Rabbit Polyclonal Phospho-Epo-R (Tyr368) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Epo-R around the phosphorylation site of Tyrosine 368
Modifications Phospho-specific

Rabbit Polyclonal EPO Receptor Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human EPO receptor protein (between residues 300-400) [UniProt P19235]

EPOR rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal Epo-R (Ab-426) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Epo-R.

EPOR Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human EPOR

Rabbit Polyclonal Anti-EPOR Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-EPOR antibody: synthetic peptide directed towards the N terminal of human EPOR. Synthetic peptide located within the following region: DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL

Rabbit Polyclonal Anti-Epor Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Epor antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGL

Carrier-free (BSA/glycerol-free) EPOR mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-EPOR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-45 amino acids of Human erythropoietin receptor

EPOR Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse EPOR

EPOR mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

EPOR mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal anti-EPOR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human EPOR

Rabbit Polyclonal anti-EPOR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human EPOR